PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_4830.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 458aa    MW: 49074.2 Da    PI: 5.9694
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_4830.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.41.3e-40156233178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC adls ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  MLOC_4830.2 156 ACQVEGCCADLSAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTRP 233
                  5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-34149218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.291154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-38155235IPR004333Transcription factor, SBP-box
PfamPF031102.1E-29157230IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDLEAARVGS QSRHLYGGGL GGELEQARRE KRVFGWDLND WSWDSERFVA TPVPAAAGNG  60
LSLNSSPSSS EEAGPEVARN GNVRVDSDKR KRVVVIHDDD NEKDDDPVGN SSNVLSLRLG  120
GGNSVAGGAA EDGGVNEEDR NGKRIRVQGG SSNGPACQVE GCCADLSAAK DYHRRHKVCE  180
MHAKANTAVV GNTVQRFCQQ CSRFHLLQEF DEGKRSCRRR LAGHNKRRRK TRPESAVGGA  240
PIEEKVSSYL LLSLLGICAN FNSDNAERVQ GQELLSNLWR NLGTVAKSLD PKELCKLLEA  300
CQNMQNGSNA GTSEAANALV NTAAAEAAGP SNSKAPFANG GQCGQSSSAV VPVQSNVPMV  360
ATTEIPACKL KNFDLNDTCN DMEGFEDGSN CPSWIRQDST QSPPQTSGNS DSTSAQSLSS  420
SNGDAQCRTD KIVFKLFEKV PSELPPILRS QDPWLVVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-32150230484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3698690.0AK369869.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2100B11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563064.10.0PREDICTED: squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLM0WC820.0M0WC82_HORVD; Uncharacterized protein
STRINGMLOC_4830.40.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.19e-65squamosa promoter binding protein-like 1